DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and YET1

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_012858.2 Gene:YET1 / 853800 SGDID:S000001548 Length:206 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:47/219 - (21%)
Similarity:93/219 - (42%) Gaps:45/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILV--IFL 63
            |||.:|.:...|..|:.::.:.|||:  |:|..|...|.:..:..:|.....:.|.|.||  :|:
Yeast     1 MSLYFTTLFLLLTVEMVMLFIFVLPL--PFRIRRGIFSTYNQLTAKQQIKTIIFITGCLVGLLFI 63

  Fly    64 LEAIREMRKYSGLQQSNEVHLNVEMQHSMKLFRA----QRNFYISGFAIFLAL-------VIRRL 117
            ....|...:.|.....|...:.......::...:    |||.|||||.::.::       :::||
Yeast    64 DSWKRSQIRVSLYHNDNSGSIGSSAVTPIQALASRAYNQRNMYISGFILYFSICIPTVMSIVKRL 128

  Fly   118 VNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGE-DTTLIELNKLRERVQELTS 181
            |.    ...|:.:.|             :..|...::...|::.| |:|     ||:|       
Yeast   129 VK----YQGLINEQE-------------KQKLNKPSSNSKKDSNEADST-----KLQE------- 164

  Fly   182 DLNREKKDKEAVKSQAESINREYD 205
            :|.:::...|.::.|.:::.:.:|
Yeast   165 ELRKKQISLEGLQKQVKNLEKYFD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 46/217 (21%)
YET1NP_012858.2 COG5374 14..206 CDD:227666 42/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12701
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3116
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.