DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and YET3

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_010211.1 Gene:YET3 / 851487 SGDID:S000002230 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:51/224 - (22%)
Similarity:100/224 - (44%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSML------GQQAHIYFLLIMGIL 59
            |||.:||:...|..||.:..:|.||:.:.||       :.|::|      .....:....::|.:
Yeast     1 MSLYYTLVFAILVVEIFMFSILALPIPSRYR-------RPLTLLLLKPFKSSTVQVAIKCVLGFI 58

  Fly    60 VIFLLEAI-------REMRKYSGLQQSNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRL 117
            ::..::.|       :|::..|..|.:..:.....::...:.|.||||.|::|..:||..|:.|.
Yeast    59 LLLFIDCINRVYSIDKELQLSSASQNNGAIIAQDRIEVLSRKFFAQRNMYLTGITLFLTFVVVRT 123

  Fly   118 VNLICTQANL---------MAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELN-KL 172
            ..|:.....:         :|.|:.....:.:|.|||:|           .|.:|....|.| :|
Yeast   124 FGLVIELLTMKDIYRASPPVASSDVKKNDSVTAEAAAQS-----------GASKDDHGDEKNFEL 177

  Fly   173 RERVQELTSDLNREKKDKEAVKSQAESIN 201
            .:::|::..::.|.|:..|:::   |.||
Yeast   178 LKKIQDIDDEIARLKEKSESLQ---EEIN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 51/224 (23%)
YET3NP_010211.1 COG5374 1..201 CDD:227666 48/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55985
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102592
Panther 1 1.100 - - LDO PTHR12701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3116
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.