DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and AT1G48440

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_564527.1 Gene:AT1G48440 / 841265 AraportID:AT1G48440 Length:129 Species:Arabidopsis thaliana


Alignment Length:151 Identity:31/151 - (20%)
Similarity:58/151 - (38%) Gaps:40/151 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLE 65
            |:|.|.:::..:..|:.:.|:|.||      :....|.:.:.                ||..:|:
plant     1 MALQWLILSYVVAVEVVITLVLTLP------YPMLLKKRVVQ----------------LVSLILQ 43

  Fly    66 AIREMRKYSGLQQ-------------SNEVHLNVEM-QHSMKLFRAQRNFYISGFAIFLALVIRR 116
            ....:..::|.|.             |:||....|. ::...:::||||..:....|.|...|.|
plant    44 PAASIVAFAGFQLLDIYWKAEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYR 108

  Fly   117 LVNLICTQANLMAQSEASFKQ 137
                ||.....:.:.||:.|:
plant   109 ----ICKYNKDLERLEATEKR 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 31/151 (21%)
AT1G48440NP_564527.1 Bap31 1..122 CDD:413240 29/146 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12701
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.