DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and AT5G42570

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_568607.1 Gene:AT5G42570 / 834264 AraportID:AT5G42570 Length:218 Species:Arabidopsis thaliana


Alignment Length:235 Identity:63/235 - (26%)
Similarity:108/235 - (45%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLEAI 67
            |::|:|    :||:||:|||:..  ||.|  :.....|..:...:..:....|...:.:.||.:|
plant     4 LLYTVI----FAEMALILLLLFK--TPLR--KLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSI 60

  Fly    68 REMRKYS--GLQQSNE----VHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQAN 126
                 ||  .:|:.:|    ::...::..|..|..|.    :.||.:||:|:|.||.:.|.....
plant    61 -----YSLVNIQRRSEDGAVLNPTDQVLASKHLLEAS----LMGFVLFLSLMIDRLHHYIRELRL 116

  Fly   127 LMAQSEASFKQAQSATAAARSLLENKNT--EKAKEAGEDTTLIELNKLRERVQELTSDLNREKK- 188
            |....|.:.||       .|...:.|.|  |:.|..||     |:..|:.:::.|.|:...:.| 
plant   117 LRKTMETAKKQ-------NRGFEDGKTTSGEEVKALGE-----EIAALKAKIKTLESESESKGKE 169

  Fly   189 ------DKEAVKSQAESINREYDRLTEEYSKLQKKI-TIG 221
                  :.||::.||:....|||||.|:...|:.:: :||
plant   170 LKGAQGETEALRKQADGFLMEYDRLLEDNQNLRNQLESIG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 55/216 (25%)
AT5G42570NP_568607.1 Bap31_Bap29_C 147..217 CDD:407872 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12701
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.