DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and AT3G05130

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_187164.1 Gene:AT3G05130 / 819675 AraportID:AT3G05130 Length:634 Species:Arabidopsis thaliana


Alignment Length:218 Identity:41/218 - (18%)
Similarity:75/218 - (34%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MGILVIFLLEAIREM--------------------RKYSGLQQSNEVHLNVEMQHSMKLFRAQRN 100
            :..:::|:....|||                    .|...::.:.:|.:..|   .::....:|:
plant   115 LDFVIVFVESQFREMCVGVDMLVKEKSDRESEIRVLKGEAIELTGKVEIEKE---QLRKVCDERD 176

  Fly   101 FYISGFAIFLALVIRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKE------ 159
            ...:||            :|...:.|.:.:.....::.:|........||::|....||      
plant   177 LIKNGF------------DLQHEEVNRLKECVVRLEEKESNLEIVIGKLESENERLVKERKVREE 229

  Fly   160 --AGEDTTLIELNKLRERVQELTSDLNR-------EKKDKEAVKSQ----AESINREYDRLTEEY 211
              .|.....|.|.|:.|..:.....|.|       ||.:.|.||.:    .|.:.|:.|:|.|..
plant   230 EIEGVKKEKIGLEKIMEEKKNEIDGLKREIKVLLSEKNEMEIVKIEQKGVIEELERKLDKLNETV 294

  Fly   212 SKLQKK------ITIGGGGNKDD 228
            ..|.|:      :.||...|.|:
plant   295 RSLTKEEKVLRDLVIGLEKNLDE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 32/187 (17%)
AT3G05130NP_187164.1 Smc <16..260 CDD:224117 25/159 (16%)
Smc <151..518 CDD:224117 37/182 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.