DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and BCAP29

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001008405.1 Gene:BCAP29 / 55973 HGNCID:24131 Length:348 Species:Homo sapiens


Alignment Length:234 Identity:83/234 - (35%)
Similarity:135/234 - (57%) Gaps:23/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIY---FLLIMGILVIF 62
            |:|.|..:|.||||||.|:|:..||.:.|.||.:.|.   .::.|:.|..:   ||.|:.:|::.
Human     1 MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFS---FNVWGKIATFWNKAFLTIIILLIVL 62

  Fly    63 LLEAIREMRKYSG---LQQSNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQ 124
            .|:|:||:||||.   :::|:....:......|||||:|||.|||||::|..||:||||.||...
Human    63 FLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQL 127

  Fly   125 ANLMAQSEASFKQAQSATAAARSLLE------------NKNTEKAKEAGEDTTLIE-LNKLRERV 176
            |..::.......||::...||:..:|            .|:.|...|| |:..|:| ..||:..:
Human   128 AKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEA-ENKKLVEDQEKLKTEL 191

  Fly   177 QELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQ 215
            ::.:..|::.:.|...:|.|:|.:::|||:|.:|:|:||
Human   192 RKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 76/222 (34%)
BCAP29NP_001008405.1 Bap31 1..220 CDD:283239 76/222 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..223 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159949
Domainoid 1 1.000 126 1.000 Domainoid score I5417
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4174
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55985
OrthoDB 1 1.010 - - D1514108at2759
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 1 1.000 - - otm40604
orthoMCL 1 0.900 - - OOG6_102592
Panther 1 1.100 - - O PTHR12701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.