DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and bcap29

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001019391.1 Gene:bcap29 / 554151 ZFINID:ZDB-GENE-050522-468 Length:240 Species:Danio rerio


Alignment Length:235 Identity:88/235 - (37%)
Similarity:132/235 - (56%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLE 65
            |:|.||.:|.|||.|||:::...||.::..||.:.||....|.|.|..:..||.::.||::..|:
Zfish     1 MTLQWTAVATFLYVEIAVLIFFCLPFISAKRWQKIFKWSIWSRLSQFWNKGFLAMIIILIVLFLD 65

  Fly    66 AIREMRKYSGLQQSNEVHLNVEM-QH-SMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLM 128
            |:||:||||...||.:..|:..| .| .|||||||||.|||||::||.||:||:|.||...|...
Zfish    66 ALREVRKYSNSDQSKDAKLHPNMFDHMHMKLFRAQRNLYISGFSLFLWLVMRRVVTLISQLATAA 130

  Fly   129 AQSEASFKQAQSATAAARSLLENKNTEK-----AKEAGEDTTLIELNKLRERVQELTSD------ 182
            ........|.::...||:..:|:....|     |||.|:.....|..:|:|.:|.|..:      
Zfish   131 DSCVDLQNQVETTNKAAKKYMEDNQILKQALADAKEGGQKADPEESKRLKEELQRLKEELKTSAD 195

  Fly   183 -LNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKITIG 221
             |.:.|.|.:.:|.|::.:.:||.||.:|:.:||.::..|
Zfish   196 ALKKSKSDLDTMKKQSDGLTKEYKRLLQEHQQLQNQMDSG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 81/217 (37%)
bcap29NP_001019391.1 Bap31 1..218 CDD:283239 80/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596235
Domainoid 1 1.000 126 1.000 Domainoid score I5353
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I4078
OMA 1 1.010 - - QHG55985
OrthoDB 1 1.010 - - D1514108at2759
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 1 1.000 - - otm26101
orthoMCL 1 0.900 - - OOG6_102592
Panther 1 1.100 - - O PTHR12701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3116
SonicParanoid 1 1.000 - - X2501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.