DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and Bcap29

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001006981.1 Gene:Bcap29 / 298943 RGDID:1359431 Length:241 Species:Rattus norvegicus


Alignment Length:236 Identity:82/236 - (34%)
Similarity:133/236 - (56%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLE 65
            |::.|..:|.||||||.|:|:..||.::|.||::.|.....:.:....:..||.|:.:||:..|:
  Rat     1 MTIQWAAVASFLYAEIGLILIFCLPFISPQRWHKIFSFSVWTKIASFWNKAFLTIIILLVVLFLD 65

  Fly    66 AIREMRKYSGLQQSNEVHLN------VEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQ 124
            |:||::|||.:   |.|..|      ...|..|:|||:|||.|||||::|..||:||||.||...
  Rat    66 AVREVKKYSSI---NVVEKNSASRPAAYEQAQMRLFRSQRNLYISGFSLFFWLVLRRLVTLITQL 127

  Fly   125 ANLMAQSEASFKQAQSATAAARSLLE-----------NKNTEKAKEAGEDTTLIE-LNKLRERVQ 177
            |..:........||::...||:..:|           |.|||:.....|:..|:| ..:|:..::
  Rat   128 AKEITNKGVLKIQAENTNKAAKKFMEENERLKLVLKNNDNTEEHVLETENKKLVEDKERLKTELK 192

  Fly   178 ELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKI 218
            :.:..|.:.:.|...:|.|:|.:::|||||.:|:|:||.::
  Rat   193 KASDALFKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 74/221 (33%)
Bcap29NP_001006981.1 Bap31 1..220 CDD:283239 74/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354016
Domainoid 1 1.000 124 1.000 Domainoid score I5379
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4088
OMA 1 1.010 - - QHG55985
OrthoDB 1 1.010 - - D1514108at2759
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 1 1.000 - - otm44745
orthoMCL 1 0.900 - - OOG6_102592
Panther 1 1.100 - - O PTHR12701
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.