DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and SPAC9E9.04

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_594577.1 Gene:SPAC9E9.04 / 2543291 PomBaseID:SPAC9E9.04 Length:188 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:51/224 - (22%)
Similarity:94/224 - (41%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYR---WNRFFKSKFLSMLGQQAHIYFLLIMGILVIF 62
            |::.:.::...|..||...::|.||:....|   .|....|.|   .|:..|:..:.|:.||::|
pombe     1 MTIYYMIVFMLLMVEIVSFVILSLPLPLKVRRAILNAISNSPF---AGRVKHVLKITIICILILF 62

  Fly    63 ---LLEAIREMRKYSGLQQSNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQ 124
               :...:|..::|.....:.....:....:....|.||||.|:.|.|:||:||:.|.  .:..:
pombe    63 ADSVRRVVRVTKEYDLAIAAPSTTESARSGYKASQFYAQRNLYLCGSALFLSLVVNRY--YLALE 125

  Fly   125 ANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKD 189
            |.:.||.:....|.|...:.        |..||                  |:||          
pombe   126 AMIAAQDKMQALQTQVEAST--------NNAKA------------------VEEL---------- 154

  Fly   190 KEAVKSQAESINREYDRLTEEYSKLQKKI 218
             |.::::.|:.::||:.|.|:|:.:.|.:
pombe   155 -ETLRTKLETRDKEYETLAEKYAAVTKTV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 46/209 (22%)
SPAC9E9.04NP_594577.1 COG5374 1..187 CDD:227666 51/224 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55985
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102592
Panther 1 1.100 - - LDO PTHR12701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3116
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.