DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and AgaP_AGAP010557

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_314530.4 Gene:AgaP_AGAP010557 / 1275292 VectorBaseID:AGAP010557 Length:231 Species:Anopheles gambiae


Alignment Length:234 Identity:148/234 - (63%)
Similarity:182/234 - (77%) Gaps:10/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLE 65
            |:|||.:||.|||.||.:|||||||:.:|.:|:|||||:||:||.:||..||.|::.:||:||||
Mosquito     1 MTLVWGIIASFLYVEIFVVLLLVLPLRSPQQWHRFFKSRFLAMLSRQAQTYFYLLLAVLVLFLLE 65

  Fly    66 AIREMRKYSGLQQSN-EVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLMA 129
            |||||||||....:: |.||||||||||:|||||||||||||||||:|||||||:||..||.|:|
Mosquito    66 AIREMRKYSSNDHTHTETHLNVEMQHSMRLFRAQRNFYISGFAIFLSLVIRRLVSLISGQAVLLA 130

  Fly   130 QSEASFKQAQSATAAARSLL------ENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKK 188
            |:|||.|||||||:|||:|:      :.|...|.|.||:.....||.|   :|.||..:|.:|:|
Mosquito   131 QAEASMKQAQSATSAARTLMNQQKDGDKKADAKDKPAGDAPNTDELKK---KVAELEQELAKERK 192

  Fly   189 DKEAVKSQAESINREYDRLTEEYSKLQKKITIGGGGNKD 227
            ||||:|||:||:|||||||||||||||||||:......|
Mosquito   193 DKEAMKSQSESLNREYDRLTEEYSKLQKKITVSSADKSD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 131/210 (62%)
AgaP_AGAP010557XP_314530.4 Bap31 1..209 CDD:283239 131/210 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 183 1.000 Domainoid score I7125
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38095
Inparanoid 1 1.050 275 1.000 Inparanoid score I5352
OMA 1 1.010 - - QHG55985
OrthoDB 1 1.010 - - D1514108at2759
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 1 1.000 - - oto106548
Panther 1 1.100 - - LDO PTHR12701
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2501
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.