DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and Bcap29

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001157562.1 Gene:Bcap29 / 12033 MGIID:101917 Length:240 Species:Mus musculus


Alignment Length:238 Identity:89/238 - (37%)
Similarity:136/238 - (57%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIY---FLLIMGILVIF 62
            |::.|..:|.||||||.|:||..||.:.|.||.:.|.   .|:.|:.|..:   ||.|:.:|:|.
Mouse     1 MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFS---FSVWGKIASFWNKAFLTIIILLIIL 62

  Fly    63 LLEAIREMRKYSGLQQSNEVHLNVEMQHS------MKLFRAQRNFYISGFAIFLALVIRRLVNLI 121
            .|:|:||:||||   .:|.|..|..::.|      |||||:|||.|||||::|..||:||||.||
Mouse    63 FLDAVREVRKYS---STNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLI 124

  Fly   122 CTQANLMAQSEASFKQAQSATAAARSLLE----------NKNTEKAKEAGEDTTLIELNK-LRER 175
            ...|..:|.......||::...||:..:|          |.|.|:.....|:..|||..: |:..
Mouse   125 TQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKLIESKENLKTE 189

  Fly   176 VQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKI 218
            :::.:..|.:.:.|...:|.|:|.:::|||||.:|:|:||.::
Mouse   190 LKKASDALLKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 81/223 (36%)
Bcap29NP_001157562.1 Bap31 1..219 CDD:283239 81/223 (36%)
Di-lysine motif 237..240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850320
Domainoid 1 1.000 121 1.000 Domainoid score I5682
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4190
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55985
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 1 1.000 - - otm42680
orthoMCL 1 0.900 - - OOG6_102592
Panther 1 1.100 - - O PTHR12701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3116
SonicParanoid 1 1.000 - - X2501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.