DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and bcap29

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001135697.1 Gene:bcap29 / 100216272 XenbaseID:XB-GENE-950368 Length:243 Species:Xenopus tropicalis


Alignment Length:237 Identity:82/237 - (34%)
Similarity:138/237 - (58%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLE 65
            |:..||.:|.|||.|:|::|:|.:|.::|.||.:.|:.:..|.:....:..||.|:.:|::..|:
 Frog     1 MTFQWTAVASFLYGEVAVLLILCIPFISPLRWKKIFRFQLWSKVSPYWNKAFLSIIVVLIVLFLD 65

  Fly    66 AIREMRKYSG---------LQQSNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLI 121
            |.||::|||.         |..|:..|::      |||||:|||.|||||::||.||:||:|:||
 Frog    66 AAREVKKYSANHLTDKNAKLYPSSYDHIH------MKLFRSQRNLYISGFSLFLWLVLRRVVSLI 124

  Fly   122 CTQANLMAQSEASFKQAQSATAAARSLLE-NKNTEK------------AKEAGEDTTLIELNKLR 173
            ...|:.:..:.|...|.::|..||:..:| |::.:|            |.:|..:....|:..|:
 Frog   125 MQLASEIESNGAMQTQVENANEAAKKYMEDNEHLKKTINSAKMDEGKWALKAENEKLKTEVESLK 189

  Fly   174 ERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQ 215
            |.::.:|..|::.:||..|:|.|.:.:.||:|.|.:|:.|||
 Frog   190 EELKRMTEALSKSQKDSSAIKKQCDGLTREFDHLLKEHEKLQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 76/225 (34%)
bcap29NP_001135697.1 Bap31 1..136 CDD:368484 54/140 (39%)
PRK14160 130..>196 CDD:237629 13/65 (20%)
Bap31_Bap29_C 183..243 CDD:375505 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4002
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514108at2759
OrthoFinder 1 1.000 - - FOG0002712
OrthoInspector 1 1.000 - - otm47781
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2501
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.