DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13901 and DPCD

DIOPT Version :9

Sequence 1:NP_001261224.1 Gene:CG13901 / 38095 FlyBaseID:FBgn0035164 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001316671.1 Gene:DPCD / 25911 HGNCID:24542 Length:214 Species:Homo sapiens


Alignment Length:224 Identity:82/224 - (36%)
Similarity:120/224 - (53%) Gaps:27/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQNWLNYLQAAEKNSMISGRARKVLYKFPDGRQMAEEYNMDTGIVQRRAWKSKSNKIMGESEW 65
            |:...||..|:.|:|.:::....|||.|.||||::|||||:..|..:..|.|:.|| .:....:|
Human     1 MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKS-ALGAMGQW 64

  Fly    66 EIELGDEPRQLNWSGNKPPGSGEETDSLAGGDFTLRESNT-----------APLLTKRITKKNIE 119
            ::|:||.         .|.|:|..      |...::|||.           .|:..::.||.:.:
Human    65 QLEVGDP---------APLGAGNL------GPELIKESNANEQSSSWICLLQPIFMRKDTKMSFQ 114

  Fly   120 WRIRNMPYSLDTYSVTADPEKRAIVVRTSNKKYYKVIPVPELDRCGVKPAQESLSVHHQFNTLII 184
            |||||:||..|.|||:.|.::|.|:|||:||||||...:|:|||..:......||..|...||||
Human   115 WRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLII 179

  Fly   185 TYQKPDILCEMEAQVLLLLKNVDTETDMD 213
            :||||..:...|:::...||.|.|....|
Human   180 SYQKPKEVVVAESELQKELKKVKTAHSND 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13901NP_001261224.1 DPCD 6..211 CDD:291574 80/215 (37%)
DPCDNP_001316671.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158090
Domainoid 1 1.000 143 1.000 Domainoid score I4666
eggNOG 1 0.900 - - E1_28N36
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9143
Inparanoid 1 1.050 145 1.000 Inparanoid score I4440
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56358
OrthoDB 1 1.010 - - D1352989at2759
OrthoFinder 1 1.000 - - FOG0008273
OrthoInspector 1 1.000 - - oto88792
orthoMCL 1 0.900 - - OOG6_106236
Panther 1 1.100 - - LDO PTHR31921
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5773
SonicParanoid 1 1.000 - - X6248
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.