DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13901 and Dpcd

DIOPT Version :9

Sequence 1:NP_001261224.1 Gene:CG13901 / 38095 FlyBaseID:FBgn0035164 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_766227.1 Gene:Dpcd / 226162 MGIID:1924407 Length:203 Species:Mus musculus


Alignment Length:208 Identity:82/208 - (39%)
Similarity:123/208 - (59%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQNWLNYLQAAEKNSMISGRARKVLYKFPDGRQMAEEYNMDTGIVQRRAWKSKSNKIMGESEW 65
            |:..:||..|::|||.:::....|.|.|.||||::|||||:..|..:..|.|:.| |.:....:|
Mouse     1 MAVTSWLEVLRSAEKTALLQDGKRMVHYLFPDGKEMAEEYDEKTSELLVRKWRVK-NALGALGQW 64

  Fly    66 EIELGDEPRQLNWSGNKPPGSGEETDSLAGGDFTLRESNTAPLLTKRITKKNIEWRIRNMPYSLD 130
            ::|:| ||        .|.|:|    ||  |...::|||..|:..::.||.:.:|||||:||..|
Mouse    65 QLEVG-EP--------VPSGAG----SL--GSELIKESNANPIFMRKDTKTSFQWRIRNLPYPKD 114

  Fly   131 TYSVTADPEKRAIVVRTSNKKYYKVIPVPELDRCGVKPAQESLSVHHQFNTLIITYQKPDILCEM 195
            .|||:...::|.::|||:||||||...:|:|||..:.....:||..|...||||:||||..:...
Mouse   115 VYSVSVAQKERCVIVRTTNKKYYKKFSIPDLDRHQLPLEDSALSFAHANCTLIISYQKPKEVMAA 179

  Fly   196 EAQVLLLLKNVDT 208
            |:::...||.|.|
Mouse   180 ESELQKELKKVKT 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13901NP_001261224.1 DPCD 6..211 CDD:291574 81/203 (40%)
DpcdNP_766227.1 DPCD 6..195 CDD:291574 81/203 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848472
Domainoid 1 1.000 141 1.000 Domainoid score I4711
eggNOG 1 0.900 - - E1_28N36
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9143
Inparanoid 1 1.050 143 1.000 Inparanoid score I4438
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008273
OrthoInspector 1 1.000 - - oto92356
orthoMCL 1 0.900 - - OOG6_106236
Panther 1 1.100 - - LDO PTHR31921
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5773
SonicParanoid 1 1.000 - - X6248
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.