DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and MLC1

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_011409.1 Gene:MLC1 / 852772 SGDID:S000003074 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:45/148 - (30%)
Similarity:76/148 - (51%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEI---------YRYSEGLEGD-V 63
            ||.|:      |.|.|.:..|.|..|.||:.:|.:|.|.|...:         .|.:..|..| :
Yeast     6 ANKDI------FTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQI 64

  Fly    64 NGYIQLTD-FIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNE 127
            .|.|::.: .:|..||    ..:.|::| |:..||.:..|.|:.|:||::...||||::|.|.:|
Yeast    65 TGLIEVNEKELDATTK----AKTEDFVK-AFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDE 124

  Fly   128 VFRQADVDGDGVINFRDF 145
            :.:..:||.:|.|:::.|
Yeast   125 LLKGVEVDSNGEIDYKKF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 45/148 (30%)
EFh 18..77 CDD:298682 18/69 (26%)
EFh 88..148 CDD:238008 21/58 (36%)
MLC1NP_011409.1 FRQ1 1..149 CDD:227455 45/148 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.