DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and AT1G32250

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:150 Identity:41/150 - (27%)
Similarity:72/150 - (48%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |..:.:.::.|.|...|..|.|.:...:||.::|.||...:..:.....:..:...||.::..:|
plant     9 LDEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKADTKSNGLVEFPEF 73

  Fly    73 IDLMTK--IYSAMGSSDY----LKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQ 131
            :.|::.  :..|..::.|    |...:..||.|.:|.:|..||.|....||..::..|...:.::
plant    74 VALVSPELLSPAKRTTPYTEEQLLRLFRIFDTDGNGFITAAELAHSMAKLGHALTVAELTGMIKE 138

  Fly   132 ADVDGDGVINFRDFCTAYRS 151
            ||.||||.|||::|..|..|
plant   139 ADSDGDGRINFQEFAKAINS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 38/143 (27%)
EFh 18..77 CDD:298682 14/58 (24%)
EFh 88..148 CDD:238008 23/63 (37%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.