DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and CML41

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_190646.1 Gene:CML41 / 824241 AraportID:AT3G50770 Length:205 Species:Arabidopsis thaliana


Alignment Length:137 Identity:33/137 - (24%)
Similarity:68/137 - (49%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDLMTK 78
            :::.:.|...|.:..|:|.|.:|.....::|:..:..........::.|.:|.:...||:.|||:
plant    63 EELRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFVGLMTR 127

  Fly    79 --IY--SAMGSSDYLKAAYNAFDFDK-DGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGDG 138
              :|  ..:.....||.|:..|:.:| .|.:|...|:.:.:.|||..:..|...:.:..|:||:|
plant   128 RDLYGDGEVDGDGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFYDIDGNG 192

  Fly   139 VINFRDF 145
            :::|.:|
plant   193 ILDFHEF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 33/137 (24%)
EFh 18..77 CDD:298682 12/58 (21%)
EFh 88..148 CDD:238008 18/59 (31%)
CML41NP_190646.1 PTZ00184 54..204 CDD:185504 33/137 (24%)
EFh 64..126 CDD:238008 12/61 (20%)
EFh 141..204 CDD:238008 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.