DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and AT3G29000

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_189542.1 Gene:AT3G29000 / 822540 AraportID:AT3G29000 Length:194 Species:Arabidopsis thaliana


Alignment Length:139 Identity:33/139 - (23%)
Similarity:57/139 - (41%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFID 74
            :||..||             .|..::...|||:||..:.:.::.......|              
plant    75 DDDDDDI-------------DISREEAEMVMRSLGLFYNDDQLQEQYSAKE-------------- 112

  Fly    75 LMTKIYSAMGSS-DYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFN--EVFRQADVDG 136
             ::.::....:| :.:|.|::.||.:|||.:...||:.|...||.|......|  .:.|..|.:.
plant   113 -VSSLFEEKEASLEEVKQAFDVFDENKDGFIDAIELQRVLTILGFKQGSYLDNCLVMIRSLDGNK 176

  Fly   137 DGVINFRDF 145
            ||.|:|.:|
plant   177 DGKIDFNEF 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 33/139 (24%)
EFh 18..77 CDD:298682 7/58 (12%)
EFh 88..148 CDD:238008 21/60 (35%)
AT3G29000NP_189542.1 EFh 126..189 CDD:238008 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.