DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and TCH3

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001189723.1 Gene:TCH3 / 818709 AraportID:AT2G41100 Length:324 Species:Arabidopsis thaliana


Alignment Length:155 Identity:46/155 - (29%)
Similarity:75/155 - (48%) Gaps:17/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |.:|.:.:..|:|.|.|....|.|...:|..||.:||:|.|::::......::.|.:|.|...:|
plant    94 LTDDQITEYRESFRLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEF 158

  Fly    73 IDLMTK--------IYSAMGSSDY---------LKAAYNAFDFDKDGLVTYGELRHVFINLGEKI 120
            :.||.|        .::.....||         .:.|:..||.:.||.:|..|||....:|||..
plant   159 LYLMAKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQ 223

  Fly   121 SDEEFNEVFRQADVDGDGVINFRDF 145
            :..|..::..:||.||||.|:|.:|
plant   224 TKAELQDMINEADADGDGTISFSEF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 46/155 (30%)
EFh 18..77 CDD:298682 18/58 (31%)
EFh 88..148 CDD:238008 23/67 (34%)
TCH3NP_001189723.1 PTZ00184 1..162 CDD:185504 19/67 (28%)
PTZ00184 90..255 CDD:185504 46/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.