DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and AT2G41090

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_181642.1 Gene:AT2G41090 / 818708 AraportID:AT2G41090 Length:191 Species:Arabidopsis thaliana


Alignment Length:143 Identity:52/143 - (36%)
Similarity:78/143 - (54%) Gaps:9/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAN----DDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQ 68
            :||    ..:.:..|.|.:.|....|.|..::.|.|||:||.|.|::|:.......:.|.:|.|.
plant     1 MANKFTRQQISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTIN 65

  Fly    69 LTDFIDLMTK-IYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQA 132
            .|:|:..|.| .||...    ||..:..||.||:|.::..|:|:|...|..|.:|||.:|:.:.|
plant    66 FTEFLCAMAKDTYSEKD----LKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAA 126

  Fly   133 DVDGDGVINFRDF 145
            ||||||.||:|:|
plant   127 DVDGDGQINYREF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 52/143 (36%)
EFh 18..77 CDD:298682 19/58 (33%)
EFh 88..148 CDD:238008 27/58 (47%)
AT2G41090NP_181642.1 PTZ00184 1..146 CDD:185504 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.