DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Calml4

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001121047.1 Gene:Calml4 / 691455 RGDID:1583918 Length:153 Species:Rattus norvegicus


Alignment Length:138 Identity:39/138 - (28%)
Similarity:71/138 - (51%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |:.:.:.:..|.|.|.|.::.|:|:|.||...||.||.:.|..|:.|:.:....|.||.:..:.|
  Rat     5 LSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTF 69

  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137
            :.:|............:..|....|.:|.|.:...|||...:.||||::.:|.:|:|::|.::.:
  Rat    70 LTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKEAGIEPN 134

  Fly   138 GVINFRDF 145
            |.:.:..|
  Rat   135 GQVKYDTF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 39/138 (28%)
EFh 18..77 CDD:298682 20/58 (34%)
EFh 88..148 CDD:238008 17/58 (29%)
Calml4NP_001121047.1 PTZ00184 1..144 CDD:185504 39/138 (28%)
EFh 12..74 CDD:238008 20/61 (33%)
EFh 94..147 CDD:298682 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.