DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Myl4

DIOPT Version :10

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:149 Identity:44/149 - (29%)
Similarity:70/149 - (46%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCDPEKTG--RIRADDLGEVMRTLGQNHTESEIYRY----------SEGLEGDV 63
            |.:::..|||.|.|...||  :|.....|:|:|.||||.|.:|:.|.          |:.|:.::
  Rat    47 DQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTLDFEM 111

  Fly    64 NGYIQLTDFIDLMTKI--YSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFN 126
                    |:.::..|  ....|:.:........||.:.:|.|...|||||...||||:|:.|..
  Rat   112 --------FLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVE 168

  Fly   127 EVFRQADVDGDGVINFRDF 145
            ::....: |.:|.||:..|
  Rat   169 QLLTGQE-DANGCINYEAF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 44/149 (30%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 44/149 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.