DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Myl4

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:149 Identity:44/149 - (29%)
Similarity:70/149 - (46%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCDPEKTG--RIRADDLGEVMRTLGQNHTESEIYRY----------SEGLEGDV 63
            |.:::..|||.|.|...||  :|.....|:|:|.||||.|.:|:.|.          |:.|:.::
  Rat    47 DQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTLDFEM 111

  Fly    64 NGYIQLTDFIDLMTKI--YSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFN 126
                    |:.::..|  ....|:.:........||.:.:|.|...|||||...||||:|:.|..
  Rat   112 --------FLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVE 168

  Fly   127 EVFRQADVDGDGVINFRDF 145
            ::....: |.:|.||:..|
  Rat   169 QLLTGQE-DANGCINYEAF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 44/149 (30%)
EFh 18..77 CDD:298682 21/70 (30%)
EFh 88..148 CDD:238008 20/58 (34%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 44/149 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.