DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and myl4

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001020354.1 Gene:myl4 / 574004 ZFINID:ZDB-GENE-050626-112 Length:187 Species:Danio rerio


Alignment Length:146 Identity:41/146 - (28%)
Similarity:66/146 - (45%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCD--PEKTGRIRADDLGEVMRTLGQNHTESEIYR-YSEGLEGDVNGYIQLTDF 72
            |.:::..|.|.|.|  |....:|.....|:|||.||.|.|.:|:.: ..:....::|     |..
Zfish    41 DQIEEFKETFMLFDRTPASEMKITYAQCGDVMRALGLNPTNAEVLKVLGKPRPEEMN-----TKM 100

  Fly    73 IDLMTKI--------YSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVF 129
            ||..|.:        ....|:.:........||.:.:|.|...|||||...||||:::.|..::.
Zfish   101 IDFETFLPMFQHVSRSKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTESEVEQLM 165

  Fly   130 RQADVDGDGVINFRDF 145
            ...: ||:|.:|:..|
Zfish   166 AGQE-DGNGCVNYEAF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 41/146 (28%)
EFh 18..77 CDD:298682 19/61 (31%)
EFh 88..148 CDD:238008 19/58 (33%)
myl4NP_001020354.1 PTZ00184 39..186 CDD:185504 41/146 (28%)
EFh 124..185 CDD:238008 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.