DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and MYL6

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_066299.2 Gene:MYL6 / 4637 HGNCID:7587 Length:151 Species:Homo sapiens


Alignment Length:142 Identity:44/142 - (30%)
Similarity:72/142 - (50%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGD-VNGYIQLTDFID 74
            |...:..|||:|.|....|:|.....|:|||.||||.|.:|:.:.....:.| :|  :::.||..
Human     7 DQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMN--VKVLDFEH 69

  Fly    75 LMTKIYSAMGS------SDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQAD 133
            .:..:.:...:      .||:: ....||.:.:|.|...|:|||.:.||||:::||. |:.....
Human    70 FLPMLQTVAKNKDQGTYEDYVE-GLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEV-EMLVAGH 132

  Fly   134 VDGDGVINFRDF 145
            .|.:|.||:..|
Human   133 EDSNGCINYEAF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 44/142 (31%)
EFh 18..77 CDD:298682 21/59 (36%)
EFh 88..148 CDD:238008 21/58 (36%)
MYL6NP_066299.2 PTZ00184 5..150 CDD:185504 44/142 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.