DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Acam

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster


Alignment Length:138 Identity:57/138 - (41%)
Similarity:85/138 - (61%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |..:.:.:..:||...|.|.||:|...:||.:|||||||.||:|:.......|.:.||.:..|:|
  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68

  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137
            ..:|.|......:.:.::.|:..||.|.||.::..|||.|.||||||::|||.:|:.|:||.|||
  Fly    69 CGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGD 133

  Fly   138 GVINFRDF 145
            |:||:.:|
  Fly   134 GMINYEEF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 57/138 (41%)
EFh 18..77 CDD:298682 24/58 (41%)
EFh 88..148 CDD:238008 30/58 (52%)
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 57/138 (41%)
EFh 11..73 CDD:238008 24/61 (39%)
EFh 84..146 CDD:238008 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.