DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and CG17272

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster


Alignment Length:135 Identity:40/135 - (29%)
Similarity:71/135 - (52%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DLQDICEAFELCDPEKTGRI-RADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDL 75
            |:.:..|.|.|.  .::|:| ..|:|..:||:||.:.|..|:..|.:    ..||.:...||:|:
  Fly     9 DIDEFRECFYLF--ARSGQINNLDELTVIMRSLGLSPTIQELVSYLK----QKNGKMSFADFLDI 67

  Fly    76 MTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGDGVI 140
            |.:........|.:.||:.|.|....|.::..:||::..|.||.:|..|.:.:||:|:|:.:..:
  Fly    68 MHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTV 132

  Fly   141 NFRDF 145
            .:.||
  Fly   133 RYADF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 40/135 (30%)
EFh 18..77 CDD:298682 19/59 (32%)
EFh 88..148 CDD:238008 18/58 (31%)
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.