DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and tnnc2

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_012827046.1 Gene:tnnc2 / 394554 XenbaseID:XB-GENE-480259 Length:163 Species:Xenopus tropicalis


Alignment Length:149 Identity:48/149 - (32%)
Similarity:78/149 - (52%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ESQD--YILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVN 64
            :.||  ..|:.:.:.:...||::.|.:..|.|...:||.|||.||||.|:.|:....|.::.|.:
 Frog     7 QQQDARSFLSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGS 71

  Fly    65 GYIQLTDFIDLMTKIY--SAMG-SSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFN 126
            |.|...:|:.:|.:..  .|.| |.:.|...:..||.:.||.:...||..:..:.||.|:|||..
 Frog    72 GTIDFEEFLVMMVRQMKEDAQGKSEEELAECFRIFDKNADGYIDGEELAEILRSSGESITDEEIE 136

  Fly   127 EVFRQADVDGDGVINFRDF 145
            |:.:..|.:.||.|:|.:|
 Frog   137 ELMKDGDKNNDGKIDFDEF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 46/141 (33%)
EFh 18..77 CDD:298682 21/58 (36%)
EFh 88..148 CDD:238008 20/58 (34%)
tnnc2XP_012827046.1 PTZ00184 15..159 CDD:185504 46/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.