DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Cabp4

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_038941368.1 Gene:Cabp4 / 365394 RGDID:1306083 Length:278 Species:Rattus norvegicus


Alignment Length:148 Identity:48/148 - (32%)
Similarity:83/148 - (56%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESQDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNG 65
            |..:|..|..::|:::..|||..|.::.|.|...:||:.|||||...||.|:...|:.::..:.|
  Rat   115 MFGKDRELGPEELEELQAAFEEFDTDQDGYIGHRELGDCMRTLGYMPTEMELLEVSQHVKMRMGG 179

  Fly    66 YIQLTDFIDLMT-----KIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVF-INLGEKISDEE 124
            ::...:|::|::     :....:|..: |:.|:..||.|:||.:|..|||... ..|||.:...|
  Rat   180 FVDFEEFVELISPKLREETAHMLGVRE-LRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTE 243

  Fly   125 FNEVFRQADVDGDGVINF 142
            .:|:.|..|::|||.|:|
  Rat   244 LDEMLRDMDLNGDGTIDF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 46/141 (33%)
EFh 18..77 CDD:298682 20/58 (34%)
EFh 88..148 CDD:238008 23/56 (41%)
Cabp4XP_038941368.1 PTZ00184 133..262 CDD:185504 44/130 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.