DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and TpnC4

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:66/139 - (47%) Gaps:4/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDL 75
            :.|:.:..||:..|.:..|.|...|:..::..|||......:....:.::....|.:..:.|..|
  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKL 73

  Fly    76 MTK---IYSAMGS-SDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDG 136
            ..:   :...:|: .:.||.|:..:|.:..|.:|...||.:...|.:|:|:::.:.:..:.|.||
  Fly    74 AARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADG 138

  Fly   137 DGVINFRDF 145
            .|.::|.:|
  Fly   139 SGTVDFDEF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 31/139 (22%)
EFh 18..77 CDD:298682 12/58 (21%)
EFh 88..148 CDD:238008 17/58 (29%)
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 31/139 (22%)
EFh 14..75 CDD:238008 12/60 (20%)
EFh 90..152 CDD:238008 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.