DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and TpnC25D

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001285619.1 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:142 Identity:34/142 - (23%)
Similarity:68/142 - (47%) Gaps:4/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDIC-EAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTD 71
            :.:|:..||. :||::.|.:|||.|....|..::.::||...:||:....:..:.:..|.:....
  Fly     1 MEDDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDG 65

  Fly    72 FIDLMTKIY---SAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQAD 133
            |..:.....   .|......||.|:..:|.:.:|.:|...|:.:...|.:|:|..:.:.:..:.|
  Fly    66 FCSIAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEID 130

  Fly   134 VDGDGVINFRDF 145
            .||.|.::|.:|
  Fly   131 TDGSGTVDFDEF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 34/142 (24%)
EFh 18..77 CDD:298682 14/58 (24%)
EFh 88..148 CDD:238008 16/58 (28%)
TpnC25DNP_001285619.1 PTZ00184 4..146 CDD:185504 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.