DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and CG31960

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster


Alignment Length:145 Identity:48/145 - (33%)
Similarity:78/145 - (53%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESQDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNG 65
            :|.|| :|.|        .:.|.|.:..|.|.:.:||.|:|.||:...|||:......::.|.||
  Fly     6 VEEQD-LLKN--------IYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNG 61

  Fly    66 YIQLTDFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFR 130
            .|...:|.:::.:........:.|:.|:..||.:.:|.::..|||.||:.||||:.|:|..|:.|
  Fly    62 SIAKEEFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIR 126

  Fly   131 QADVDGDGVINFRDF 145
            :.|:|.|..|||.:|
  Fly   127 EYDLDQDNHINFEEF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 45/138 (33%)
EFh 18..77 CDD:298682 18/58 (31%)
EFh 88..148 CDD:238008 25/58 (43%)
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 48/145 (33%)
EFh 12..72 CDD:238008 20/67 (30%)
EFh 84..146 CDD:238008 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.