DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and CG11638

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:149 Identity:46/149 - (30%)
Similarity:82/149 - (55%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            ::...:::..|||.|.|.:..|.|..::||.|||:|||.....|:....:.::.|.:|.:...:|
  Fly   206 ISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEF 270

  Fly    73 IDLMTKI----YSAMGSSDY----LKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVF 129
            :|:::.:    .|.:.|:|.    |:.|:..||....|.:|..:||.|...|||.:.:|:..::.
  Fly   271 VDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMI 335

  Fly   130 RQADVDGDGVINFRDFCTA 148
            ::.||||||.|:|.:|..|
  Fly   336 KEVDVDGDGRIDFYEFVHA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 44/145 (30%)
EFh 18..77 CDD:298682 20/58 (34%)
EFh 88..148 CDD:238008 22/63 (35%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 20/61 (33%)
EF-hand_7 215..274 CDD:290234 20/58 (34%)
EFh 294..355 CDD:238008 23/61 (38%)
EF-hand_7 295..355 CDD:290234 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.