DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Cabp5

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_038905.1 Gene:Cabp5 / 29865 MGIID:1352746 Length:173 Species:Mus musculus


Alignment Length:143 Identity:49/143 - (34%)
Similarity:81/143 - (56%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |..|:|.::.|||...|.::.|.|...|||.:|||:|...||.|:....:.:..::.|.:...||
Mouse    25 LGQDELDELREAFLEFDKDQDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDF 89

  Fly    73 IDLMT-KIY---SAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFIN-LGEKISDEEFNEVFRQA 132
            ::||| |:.   :.|.....::.|:..||.:.||.:|..||:..... ||||::..|..||.::|
Mouse    90 VELMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIAEVVQEA 154

  Fly   133 DVDGDGVINFRDF 145
            |::|||.::|.:|
Mouse   155 DINGDGTVDFEEF 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 49/143 (34%)
EFh 18..77 CDD:298682 20/58 (34%)
EFh 88..148 CDD:238008 22/59 (37%)
Cabp5NP_038905.1 PTZ00184 25..171 CDD:185504 49/143 (34%)
EFh 32..94 CDD:238008 20/61 (33%)
EFh 109..172 CDD:238008 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1068
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.