DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and CG30378

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:144 Identity:58/144 - (40%)
Similarity:82/144 - (56%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |....:::|.|||.|.|.|::|.:....||.|||.||::.||:|||..:.....|..|.:|..||
  Fly     5 LTEAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKDF 69

  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137
            :.:|:|......|...||.|:..||..:....|..|:|.|..|||||:|:|:..|:|:..|.|.|
  Fly    70 LYVMSKRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDIDQDKD 134

  Fly   138 GVINFRDFCTAYRS 151
            |.|:|.:|.||.||
  Fly   135 GKISFNEFVTAMRS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 53/137 (39%)
EFh 18..77 CDD:298682 24/58 (41%)
EFh 88..148 CDD:238008 25/59 (42%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 56/142 (39%)
EFh 12..74 CDD:238008 25/61 (41%)
EFh 86..147 CDD:238008 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.