DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13898 and Myl6b

DIOPT Version :9

Sequence 1:	NP_612058.1	Gene:	CG13898 / 38092	FlyBaseID:	FBgn0035161	Length:	151	Species:	Drosophila melanogaster
Sequence 2:	NP_758463.1	Gene:	Myl6b / 216459	MGIID:	1917789	Length:	207	Species:	Mus musculus

Alignment Length:	140	Identity:	46/140 - (32%)
Similarity:	68/140 - (48%)	Gaps:	7/140 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 DDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRY-----SEGLEGDVNGYIQLT 70
            |.|::..|||||.|....|:|.....|::||.||||.|.:|:.:.     :|.|:.....:....
Mouse    63 DQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPKNEELKSRRVDFETFL 127

  Fly    71 DFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVD 135
            ..:..:.|........|||: ....||.:.:|.|...|||||...||||:::||...|....: |
Mouse   128 PMLQAVAKNRDQGTYEDYLE-GLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHE-D 190

  Fly   136 GDGVINFRDF 145
            .:|.||:..|
Mouse   191 SNGCINYEAF 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13898	NP_612058.1	PTZ00184	8..146	CDD:185504	46/140 (33%)
		EFh	18..77	CDD:298682	19/63 (30%)
		EFh	88..148	CDD:238008	23/58 (40%)
Myl6b	NP_758463.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..50
		PTZ00184	57..206	CDD:185504	46/140 (33%)
		EFh	67..131	CDD:298682	19/63 (30%)
		EFh	67..95	CDD:197492	11/27 (41%)
		EFh	150..204	CDD:238008	21/52 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1470794at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010