DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Myl6b

DIOPT Version :10

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_758463.1 Gene:Myl6b / 216459 MGIID:1917789 Length:207 Species:Mus musculus


Alignment Length:140 Identity:46/140 - (32%)
Similarity:68/140 - (48%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRY-----SEGLEGDVNGYIQLT 70
            |.|::..|||||.|....|:|.....|::||.||||.|.:|:.:.     :|.|:.....:....
Mouse    63 DQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPKNEELKSRRVDFETFL 127

  Fly    71 DFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVD 135
            ..:..:.|........|||: ....||.:.:|.|...|||||...||||:::||...|....: |
Mouse   128 PMLQAVAKNRDQGTYEDYLE-GLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHE-D 190

  Fly   136 GDGVINFRDF 145
            .:|.||:..|
Mouse   191 SNGCINYEAF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 46/140 (33%)
Myl6bNP_758463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
PTZ00184 57..206 CDD:185504 46/140 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.