DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and cal-5

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_508864.2 Gene:cal-5 / 192083 WormBaseID:WBGene00006861 Length:156 Species:Caenorhabditis elegans


Alignment Length:139 Identity:47/139 - (33%)
Similarity:73/139 - (52%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            :..|||:.|...|:|   ...|.|:.::|..||:.:||:.||.|:....:..:.|.:|.|...:|
 Worm    18 IREDDLKGIFREFDL---NGDGYIQREELRAVMQKMGQSPTEDELDAMFQAADKDCDGNIDFQEF 79

  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137
            :    .|..|...|..|||.:...|.|.||.:|..|||..|..:|..:||::...::|..|.:.|
 Worm    80 L----VIAKANPLSLSLKAVFEELDVDGDGYITRSELRTAFQRMGHSLSDQDIKAIYRHVDQNND 140

  Fly   138 GVINFRDFC 146
            |.|||::||
 Worm   141 GKINFQEFC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 45/137 (33%)
EFh 18..77 CDD:298682 16/58 (28%)
EFh 88..148 CDD:238008 24/59 (41%)
cal-5NP_508864.2 PTZ00184 22..155 CDD:185504 46/135 (34%)
EFh 22..84 CDD:238008 20/68 (29%)
EFh 92..153 CDD:238008 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.