DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and C50C3.5

DIOPT Version :10

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_498786.3 Gene:C50C3.5 / 183642 WormBaseID:WBGene00016801 Length:189 Species:Caenorhabditis elegans


Alignment Length:95 Identity:25/95 - (26%)
Similarity:40/95 - (42%) Gaps:13/95 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EGLEGDVNGYIQLTDFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKIS 121
            |.::...|.|......::.:.||:..|             |.|..|.::..|:..:...||..:|
 Worm    33 ENIDDLANRYEVSKQEVEKVFKIFQLM-------------DDDGSGTISSSEVAKMLNELGIDVS 84

  Fly   122 DEEFNEVFRQADVDGDGVINFRDFCTAYRS 151
            .:....|.|.:||.|||.|:|.:|..|..|
 Worm    85 PKVVQAVMRSSDVSGDGQIDFEEFLAAVTS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 22/88 (25%)
C50C3.5NP_498786.3 EFh 51..113 CDD:238008 21/74 (28%)
EFh_PI-PLC 54..185 CDD:333715 22/74 (30%)
EF-hand motif 54..80 CDD:320029 7/38 (18%)
EF-hand motif 87..119 CDD:320029 12/28 (43%)
EF-hand motif 124..153 CDD:320029
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.