DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and cal-2

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_495906.2 Gene:cal-2 / 182789 WormBaseID:WBGene00000286 Length:171 Species:Caenorhabditis elegans


Alignment Length:142 Identity:44/142 - (30%)
Similarity:82/142 - (57%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |..:::.:...||.|.|.:..|.|.:.:||..||:||||.||.|:......::.|.:|.|...:|
 Worm    29 LNEEEIMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFGEF 93

  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137
            ..:|.:: :....|:.::.|:..||.|.:|.:|..|.|:...::|::.||:|.:|:..:.|:|||
 Worm    94 CQMMKRM-NKENDSEMIREAFRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDIDGD 157

  Fly   138 GVINFRDFCTAY 149
            |.|::.:|.:.:
 Worm   158 GQIDYEEFASTF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 43/137 (31%)
EFh 18..77 CDD:298682 21/58 (36%)
EFh 88..148 CDD:238008 20/59 (34%)
cal-2NP_495906.2 PTZ00184 27..165 CDD:185504 43/136 (32%)
EFh 36..98 CDD:238008 21/61 (34%)
EFh 108..166 CDD:238008 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.