DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and F43C9.2

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_508818.1 Gene:F43C9.2 / 180753 WormBaseID:WBGene00018376 Length:159 Species:Caenorhabditis elegans


Alignment Length:146 Identity:42/146 - (28%)
Similarity:78/146 - (53%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEI-YRYSEGLEGDVNGYI 67
            |.|:|  |||| :.|.|:|.|.:|.||:..:::..::||:....|..|: :.:.| ::.|..|.|
 Worm    15 QRYVL--DDLQ-LSETFDLLDVDKDGRLSRNEIAALLRTINVEPTRVELDFIFGE-MDTDKTGKI 75

  Fly    68 QLTDFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVF---INLGEKISDEEFNEVF 129
            ...:|::.|........:...|:..:..||.|.||.:|..|:..:.   .:||::.:   .:::|
 Worm    76 SKEEFVNYMKSPPIHRTTLRELEVQFRKFDSDGDGAITEDEMAEILRRTADLGDRAA---ISDMF 137

  Fly   130 RQADVDGDGVINFRDF 145
            :..|::|||.|.|.:|
 Worm   138 KATDLNGDGKITFFEF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 40/142 (28%)
EFh 18..77 CDD:298682 16/59 (27%)
EFh 88..148 CDD:238008 18/61 (30%)
F43C9.2NP_508818.1 EF-hand_7 24..84 CDD:290234 16/60 (27%)
EFh 25..85 CDD:298682 16/60 (27%)
EFh 96..158 CDD:238008 18/61 (30%)
EF-hand_7 101..157 CDD:290234 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.