DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and cal-1

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:145 Identity:50/145 - (34%)
Similarity:86/145 - (59%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SQDYI--LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNG 65
            |:|.|  |..:::.:..|||.:.|.:..|.|...:||..||:||||.||.||......::.|.||
 Worm    30 SEDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNG 94

  Fly    66 YIQLTDFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFR 130
            .|:..:|..:|.::.... .|:.::.|:..||.|.:|::|..|.|:..:::|.:.|:||.:|:.:
 Worm    95 QIEFPEFCVMMKRMMKET-DSEMIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIK 158

  Fly   131 QADVDGDGVINFRDF 145
            :.||||||.|::.:|
 Worm   159 EVDVDGDGEIDYEEF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 47/138 (34%)
EFh 18..77 CDD:298682 23/58 (40%)
EFh 88..148 CDD:238008 21/58 (36%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1068
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.750

Return to query results.
Submit another query.