DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Myl3

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001351413.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:141 Identity:39/141 - (27%)
Similarity:71/141 - (50%) Gaps:7/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDLQDICEAFELCD--PEKTGRIRADDLGEVMRTLGQNHTESEIYR-YSEGLEGDVNG-YIQLTD 71
            :.:::..|||.|.|  |:...:|.....|:|:|.||||.|::|:.| ..:..:.::|. .:....
Mouse    58 EQIEEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFET 122

  Fly    72 FIDLMTKIYSAMGSSDY--LKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADV 134
            |:.::..|.....:..|  .......||.:.:|.|...|||||...|||:::::|..::....: 
Mouse   123 FLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQE- 186

  Fly   135 DGDGVINFRDF 145
            |.:|.||:..|
Mouse   187 DSNGCINYEAF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 39/141 (28%)
EFh 18..77 CDD:298682 19/62 (31%)
EFh 88..148 CDD:238008 19/60 (32%)
Myl3NP_001351413.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
EFh_PEF 53..203 CDD:330173 39/141 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.