DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and cal-3

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:138 Identity:43/138 - (31%)
Similarity:74/138 - (53%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72
            |..:::.:..|||.|.|.:..|.|...:||..||.||||.||.::......::.|.||.::..:|
 Worm    93 LTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVEFPEF 157

  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137
            ..:|.:|.... .|:.::.|:..||.|.:|::|..|.:...||:|....:.|..|:..:.|.||:
 Worm   158 CVMMKRIMKET-DSEMIREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDGN 221

  Fly   138 GVINFRDF 145
            |.|::.:|
 Worm   222 GEIDYEEF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 43/138 (31%)
EFh 18..77 CDD:298682 21/58 (36%)
EFh 88..148 CDD:238008 18/58 (31%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 43/138 (31%)
EFh 100..162 CDD:238008 21/61 (34%)
EFh 172..234 CDD:238008 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.890

Return to query results.
Submit another query.