DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and Cabp1

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001028848.1 Gene:Cabp1 / 171051 RGDID:620385 Length:350 Species:Rattus norvegicus


Alignment Length:148 Identity:46/148 - (31%)
Similarity:80/148 - (54%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQ 68
            ||..|..::::::.|||...|.:|.|.|...|||..|||:|...||.|:...|:.:..::.|::.
  Rat   198 QDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVD 262

  Fly    69 LTDFIDLM-----TKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFIN-LGEKISDEEFNE 127
            ..||::||     .:....:|..: |:.|:..||.:.||.::..|||..... ||.::...:..|
  Rat   263 FDDFVELMGPKLLAETADMIGVKE-LRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEE 326

  Fly   128 VFRQADVDGDGVINFRDF 145
            :.|..|::|||.::|.:|
  Rat   327 IIRDVDLNGDGRVDFEEF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 44/144 (31%)
EFh 18..77 CDD:298682 23/63 (37%)
EFh 88..148 CDD:238008 19/59 (32%)
Cabp1NP_001028848.1 PTZ00184 201..348 CDD:185504 44/145 (30%)
EFh 209..312 CDD:238008 33/103 (32%)
EFh 286..349 CDD:238008 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.