DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13898 and zgc:163073

DIOPT Version :9

Sequence 1:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001082980.1 Gene:zgc:163073 / 100037358 ZFINID:ZDB-GENE-070410-135 Length:213 Species:Danio rerio


Alignment Length:140 Identity:42/140 - (30%)
Similarity:69/140 - (49%) Gaps:12/140 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRY-----SEGLEGDVNGYIQLTDF 72
            |::..|||:|.....:| |.....|:|||.||||.|.:|:...     .|.:|..:   |....|
Zfish    72 LEEFKEAFQLFARSPSG-ISLAQCGDVMRALGQNPTNAEVLNVLGKPKPEEMESKL---IDFETF 132

  Fly    73 IDLMTKIYSA--MGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVD 135
            :.::.::..:  .||.:........||.:.:|.|...|||||...|||::|:.|.:::....: |
Zfish   133 LPMLQQVSKSTESGSFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLSEGEVDQLLAGQE-D 196

  Fly   136 GDGVINFRDF 145
            .:|.||:..|
Zfish   197 TNGCINYEAF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 42/140 (30%)
EFh 18..77 CDD:298682 20/63 (32%)
EFh 88..148 CDD:238008 19/58 (33%)
zgc:163073NP_001082980.1 PTZ00184 70..212 CDD:185504 42/140 (30%)
EFh 150..211 CDD:238008 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.