DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and id3

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001016271.1 Gene:id3 / 549025 XenbaseID:XB-GENE-495261 Length:118 Species:Xenopus tropicalis


Alignment Length:102 Identity:34/102 - (33%)
Similarity:51/102 - (50%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IQRHPTHRGDGENAEMKMY------LSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETH 82
            |.|..:|:|.|.:..|.:.      .||||:|||.:|:..||:::||:|||||||.|||..|...
 Frog    27 IARGSSHKGPGVDEPMGLLYDMNGCYSKLKELVPGIPQGSKLSQVEILQHVIDYIFDLQIVLGED 91

  Fly    83 PEMGNFDAAAALTAVNGLHEDEDSDMEDADAEAEAEV 119
            .:.            |.:...:.||..:...:.:|.|
 Frog    92 QQQ------------NSILNLQKSDFSELATQGDASV 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 23/48 (48%)
id3NP_001016271.1 bHLH_dnHLH_ID3 27..87 CDD:381536 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11038
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm48571
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.