powered by:
Protein Alignment emc and id2
DIOPT Version :9
Sequence 1: | NP_523876.2 |
Gene: | emc / 38091 |
FlyBaseID: | FBgn0000575 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_988885.1 |
Gene: | id2 / 394480 |
XenbaseID: | XB-GENE-481297 |
Length: | 132 |
Species: | Xenopus tropicalis |
Alignment Length: | 63 |
Identity: | 31/63 - (49%) |
Similarity: | 44/63 - (69%) |
Gaps: | 8/63 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHP--------EMGNFDAAAALTAVN 98
||||:|||.:|:|:|::|:||:|||||||.|||..|::|| .:|...:...|||:|
Frog 44 SKLKELVPSIPQNKKVSKMEILQHVIDYILDLQLALDSHPSIVSLHHARVGGSTSRTPLTALN 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
54 |
1.000 |
Domainoid score |
I11038 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1624054at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000920 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48571 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11723 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1045 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 8.020 |
|
Return to query results.
Submit another query.