DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and id2

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_988885.1 Gene:id2 / 394480 XenbaseID:XB-GENE-481297 Length:132 Species:Xenopus tropicalis


Alignment Length:63 Identity:31/63 - (49%)
Similarity:44/63 - (69%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHP--------EMGNFDAAAALTAVN 98
            ||||:|||.:|:|:|::|:||:|||||||.|||..|::||        .:|...:...|||:|
 Frog    44 SKLKELVPSIPQNKKVSKMEILQHVIDYILDLQLALDSHPSIVSLHHARVGGSTSRTPLTALN 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 23/35 (66%)
id2NP_988885.1 bHLH_dnHLH_ID2 18..83 CDD:381535 24/38 (63%)
Nuclear export signal. /evidence=ECO:0000250 105..114 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11038
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm48571
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1045
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.