DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and ID3

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_002158.3 Gene:ID3 / 3399 HGNCID:5362 Length:119 Species:Homo sapiens


Alignment Length:90 Identity:33/90 - (36%)
Similarity:46/90 - (51%) Gaps:15/90 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RGDGENAEMKMYL--------SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGN 87
            ||.|..||..:.|        |:|::|||.:|:..:|:::||:|.|||||.|||..| ..|..|.
Human    28 RGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVL-AEPAPGP 91

  Fly    88 FDA------AAALTAVNGLHEDEDS 106
            .|.      .|.||....:..|:.|
Human    92 PDGPHLPIQTAELTPELVISNDKRS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 21/50 (42%)
ID3NP_002158.3 HLH <42..85 CDD:238036 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143882
Domainoid 1 1.000 54 1.000 Domainoid score I11210
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm41367
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.