DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and ID2

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_002157.2 Gene:ID2 / 3398 HGNCID:5361 Length:134 Species:Homo sapiens


Alignment Length:144 Identity:42/144 - (29%)
Similarity:65/144 - (45%) Gaps:56/144 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGNFDAAAALTAVNGLHEDEDSDM 108
            ||||:|||.:|:|:|::|:||:|||||||.|||..|::||           |.|:          
Human    44 SKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHP-----------TIVS---------- 87

  Fly   109 EDADAEAEAEVDPDILAQRLNAEQPAKVSSPAARLPLTDRQTPNTLVAPAHPQQHQQQQQLQLQQ 173
                               |:.::|.:  :.|:|.|||...|..::              |.||.
Human    88 -------------------LHHQRPGQ--NQASRTPLTTLNTDISI--------------LSLQA 117

  Fly   174 QQLQSQQQLSNSLA 187
            .:..|:...::|.|
Human   118 SEFPSELMSNDSKA 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 23/35 (66%)
ID2NP_002157.2 bHLH_dnHLH_ID2 18..83 CDD:381535 24/38 (63%)
Nuclear export signal. /evidence=ECO:0000250 106..115 2/22 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143884
Domainoid 1 1.000 54 1.000 Domainoid score I11210
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm41367
orthoMCL 1 0.900 - - OOG6_108505
Panther 1 1.100 - - O PTHR11723
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1045
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.