DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and Id4

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_783172.2 Gene:Id4 / 291023 RGDID:631428 Length:161 Species:Rattus norvegicus


Alignment Length:48 Identity:26/48 - (54%)
Similarity:37/48 - (77%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEM 85
            :|....::|:.|||.:|.|:|::|:||:|||||||.|||..|||||.:
  Rat    67 DMNDCYTRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPAL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 21/41 (51%)
Id4NP_783172.2 bHLH_dnHLH_ID4 62..117 CDD:381537 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337664
Domainoid 1 1.000 55 1.000 Domainoid score I10836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm45490
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1045
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.910

Return to query results.
Submit another query.