DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and id2a

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_958448.1 Gene:id2a / 266599 ZFINID:ZDB-GENE-020910-1 Length:137 Species:Danio rerio


Alignment Length:63 Identity:29/63 - (46%)
Similarity:41/63 - (65%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELET--------HPEMGNFDAAAALTAVN 98
            ||||:|||.:|:|:.::|:||:|||||||.|||..|::        ||..|...:...||.:|
Zfish    48 SKLKELVPSIPQNKNVSKMEILQHVIDYILDLQIALDSNSAITSLHHPRAGQGTSRTPLTTLN 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 22/35 (63%)
id2aNP_958448.1 HLH <42..83 CDD:238036 22/34 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576825
Domainoid 1 1.000 53 1.000 Domainoid score I11334
eggNOG 1 0.900 - - E1_2CI6V
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm25470
orthoMCL 1 0.900 - - OOG6_108505
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1045
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.